PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G066900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WRKY
Protein Properties Length: 446aa    MW: 48882 Da    PI: 6.5057
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G066900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY88.74.9e-28175230259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         dDgynWrKYGqK vkg ++prsYY+Ct  +Cpv+k+ve+s+ d+k+++i+Y+g+H he
  Brast06G066900.1.p 175 DDGYNWRKYGQKAVKGGRYPRSYYKCTL-NCPVRKNVEHSE-DGKIIKIIYRGQHSHE 230
                         8*************************97.7**********9.***************8 PP

2WRKY101.16.4e-32339397159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+v+g+++prsYY+Ct++gC vkk++ers+++p++v++tYeg+H h+
  Brast06G066900.1.p 339 LDDGYRWRKYGQKVVRGNPHPRSYYKCTHQGCDVKKHIERSSQEPHAVITTYEGKHVHD 397
                         59*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-25171232IPR003657WRKY domain
SuperFamilySSF1182905.49E-22173232IPR003657WRKY domain
SMARTSM007742.2E-29174231IPR003657WRKY domain
PfamPF031068.2E-23175229IPR003657WRKY domain
PROSITE profilePS5081121.631175232IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.4E-34326399IPR003657WRKY domain
SuperFamilySSF1182904.58E-28332399IPR003657WRKY domain
PROSITE profilePS5081135.45334399IPR003657WRKY domain
SMARTSM007741.5E-36339398IPR003657WRKY domain
PfamPF031063.3E-24340396IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 446 aa     Download sequence    Send to blast
MAAGQWSGGG LWAPPSAAPE SLFPDESAPG AAVLGTFGAG GLQAQLHSLP PLCAAALLGY  60
PQDNFDMFHA QDLAQLAAQV AQKAELEETQ SGELNPKITH QLAYTKYSIL DQAHNSSFSS  120
ATSAQTSQHV SSSVIVPSMR CVPTLPSHTE CIKTESNRVS QVLQGASITL DRPADDGYNW  180
RKYGQKAVKG GRYPRSYYKC TLNCPVRKNV EHSEDGKIIK IIYRGQHSHE RPSKRYKDCD  240
ILLKESDDFN DTEDASTKSQ LDCLGYDGRP VTSIGTVADY LLPTREGGDE KVSGTSDNQG  300
EGDDETQTAD EAVRDTDANE RNAPGQKIIV STTSDVDLLD DGYRWRKYGQ KVVRGNPHPR  360
SYYKCTHQGC DVKKHIERSS QEPHAVITTY EGKHVHDVPV SRNRSRDAGQ PYCTEQTYSE  420
QSSASFCSRS EKAKYSTIIL KHLAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-33175399878Probable WRKY transcription factor 4
2lex_A2e-33175399878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562765.10.0PREDICTED: probable WRKY transcription factor 3 isoform X1
TrEMBLI1GSR70.0I1GSR7_BRADI; Uncharacterized protein
STRINGBRADI1G22680.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.18e-69WRKY DNA-binding protein 3